PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G15500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 406aa    MW: 43986.4 Da    PI: 9.5844
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G15500.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.11e-13103149148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT e+de l ++v  +G + W+ Ia+ ++ g  +kqc++rw+++l
     OB07G15500.1 103 KGGWTREDDEVLRKLVGHHGVHKWAEIAKSLP-GQIEKQCRERWRNHL 149
                      688*****************************.*************97 PP

2Myb_DNA-binding38.72.3e-12157197345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT++Ed +l++a k +G+  W+  a+ +  gR ++ +k++w+
     OB07G15500.1 157 IWTEDEDNILIKARKSYGNC-WSVLAKFLH-GRPENAIKNHWN 197
                      6*****************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.4398153IPR017930Myb domain
SuperFamilySSF466892.92E-26100196IPR009057Homeodomain-like
SMARTSM007172.7E-13102151IPR001005SANT/Myb domain
PfamPF002497.5E-13103149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-23105157IPR009057Homeodomain-like
CDDcd001672.05E-13106149No hitNo description
PROSITE profilePS5129415.597154204IPR017930Myb domain
SMARTSM007173.9E-12154202IPR001005SANT/Myb domain
CDDcd001671.00E-10158197No hitNo description
Gene3DG3DSA:1.10.10.603.6E-17158201IPR009057Homeodomain-like
PfamPF002491.4E-10158197IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MAGLNRLSGK RNILIHAWRV DGGRWELLSQ RGVGSSHGGP DYQNIGCLVA SIGMAPSSFV  60
MPEEGLAAIG YGDLTVIPVG ANMVPQQQQI HVGGCNDNRG LHKGGWTRED DEVLRKLVGH  120
HGVHKWAEIA KSLPGQIEKQ CRERWRNHLQ PDIKKDIWTE DEDNILIKAR KSYGNCWSVL  180
AKFLHGRPEN AIKNHWNATR RRLSSKRRLR RKNGGARGGP SPLEEYIRSC IRDERAQMAA  240
RSRTAPPPPP XSGVVGSGTG WLVGASATAT PPAAVQVPDS SAARGMVTFL DLLNGDSPRS  300
QPETMNLLHV PMPAEAPEPQ LTSSGCCLQL DAGGNLYYGR LPPAPAQPQE IAALELQAQC  360
LSLHHQPPAS FAWSHAADSG AESNQASGYY GDAGAGPSGR RRRRHG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-331012025106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006658469.10.0PREDICTED: myb-related protein Zm1-like
TrEMBLJ3MJG80.0J3MJG8_ORYBR; Uncharacterized protein
STRINGOB07G15500.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.15e-37myb domain protein 118